PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 441aa    MW: 49184.3 Da    PI: 6.8274
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15891.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52151431128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s +
  KHN15891.1  15 VPPGFRFHPTEEELLQYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQEKCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS-N 111
                 69****************************.9***************964444222455**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  KHN15891.1 112 GKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                 99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-599175IPR003441NAC domain
PROSITE profilePS5100557.3715175IPR003441NAC domain
PfamPF023651.7E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MPENMSISVN GQSQVPPGFR FHPTEEELLQ YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QEKCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNNTSD TNIVSNVMAD AAQEEGWVVC RIFKKKNHLK  180
TLDSPIASGE GRRSHMFDSC DEGALEQILQ QMGRGCKEES SYEGNYNSYG RFAMGLNNGG  240
GGGYNDRFMK LPSLESPKSA SMENHHNTNN NCNNNMKSNN NNNNNNNGYH PIIPVEMGTD  300
NEGTFTTHQV SGGDPNNNNS NIVHPLEVGS GGGGLTNWAA LDRLVASQLN GQTDASRQLG  360
CAFNDPTMYC TSVDHHDLHH QIPTLRSSST SANTRPSPAP AFINPPTQDF TSEIDLWNFS  420
RSTSSLLASS EPLCHVSNTS V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4891789171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ1735220.0KJ173522.1 Glycine max NAC domain transcription factor (SHAT1-5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304606.10.0NAC domain-containing protein 43-like
SwissprotQ84WP61e-137NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0B2Q2T20.0A0A0B2Q2T2_GLYSO; NAC domain-containing protein 43
STRINGGLYMA16G02200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-122NAC family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]